PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01363.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 462aa    MW: 51761.2 Da    PI: 6.7419
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01363.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.31.3e-48261791128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk............................kvkaeekew 58 
                              l+pGfrFhPtd+elv++yLk+kv gk++++ ++i +vdiyk+ePwdL                               +k++++ew
  Rsa1.0_01363.1_g00003.1  26 LAPGFRFHPTDDELVSYYLKRKVLGKPVRF-DAIGDVDIYKHEPWDLAVfwassklrlltqfwrkdmkfvdaslafsWLKTRDQEW 110
                              579************************999.99**************856899**************99999998886777999** PP

                      NAM  59 yfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              yf++  dkky +g r nrat+ gyWkatgkd+e+ s + +l g+kktLvf++grap+g +t+Wvmheyrl
  Rsa1.0_01363.1_g00003.1 111 YFYCALDKKYGNGARMNRATNLGYWKATGKDREIRS-DVQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 179
                              ************************************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-542071IPR003441NAC domain
PROSITE profilePS5100552.81526203IPR003441NAC domain
PfamPF023651.4E-2528179IPR003441NAC domain
SuperFamilySSF1019415.23E-54100204IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MGRESVTAVS SPPTATATAT AVATALAPGF RFHPTDDELV SYYLKRKVLG KPVRFDAIGD  60
VDIYKHEPWD LAVFWASSKL RLLTQFWRKD MKFVDASLAF SWLKTRDQEW YFYCALDKKY  120
GNGARMNRAT NLGYWKATGK DREIRSDVQL LGMKKTLVFH SGRAPDGLRT NWVMHEYRLV  180
DCETENNGNS VQDAYVLCRI FHKNNIGPPS GNRYAPFMEE EWAGDGVALI PGVNVSVKAE  240
PVPVANGNNH MDQEIQSASK DLININEPPR EPAPMDIELN HHENAVKPQE NNNNSNHCDE  300
GERPPAVCVL NKEAPLPLVQ YKRRRQNESS DNNNDSSRTP EDYCSSTTTT VDNTPTLISS  360
SPAAAAATNS AISALLEFSL MGISKKKENA QQTVRPHKEA TTLKEKLNDL QKEIEKMSDE  420
RKTFKLEMMG AEAMISILQS RIDALRQEND ELKKNSSAAN GH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-422520516167NAC domain-containing protein 19
4dul_A7e-422520516167NAC domain-containing protein 19
1ut7_B7e-422520516167NO APICAL MERISTEM PROTEIN
1ut7_A7e-422520516167NO APICAL MERISTEM PROTEIN
1ut4_B7e-422520516167NO APICAL MERISTEM PROTEIN
1ut4_A7e-422520516167NO APICAL MERISTEM PROTEIN
3swp_D8e-422520519170NAC domain-containing protein 19
3swp_C8e-422520519170NAC domain-containing protein 19
3swp_B8e-422520519170NAC domain-containing protein 19
3swp_A8e-422520519170NAC domain-containing protein 19
3swm_D8e-422520519170NAC domain-containing protein 19
3swm_C8e-422520519170NAC domain-containing protein 19
3swm_B8e-422520519170NAC domain-containing protein 19
3swm_A8e-422520519170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667520.0KC966752.1 Brassica napus NAC transcription factor 50 (NAC50.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750304.10.0PREDICTED: NAC domain-containing protein 26-like isoform X1
RefseqXP_013750305.10.0PREDICTED: NAC domain-containing protein 26-like isoform X2
TrEMBLA0A078F5F00.0A0A078F5F0_BRANA; BnaA05g28370D protein
STRINGBra001365.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.20.0NAC domain containing protein 52